Lineage for d4zwvb1 (4zwv B:1-369)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504331Species Actinomadura melliaura [TaxId:360723] [269170] (2 PDB entries)
  8. 2504333Domain d4zwvb1: 4zwv B:1-369 [273603]
    Other proteins in same PDB: d4zwva2, d4zwvb2
    automated match to d1mdoa_
    complexed with gol

Details for d4zwvb1

PDB Entry: 4zwv (more details), 1.5 Å

PDB Description: crystal structure of aminotransferase atms13 from actinomadura melliaura
PDB Compounds: (B:) Putative aminotransferase

SCOPe Domain Sequences for d4zwvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zwvb1 c.67.1.0 (B:1-369) automated matches {Actinomadura melliaura [TaxId: 360723]}
miplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsglcl
alrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkispat
raiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgnmcv
fsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwhmtd
lnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkvddr
pafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqdreh
vvatirsgw

SCOPe Domain Coordinates for d4zwvb1:

Click to download the PDB-style file with coordinates for d4zwvb1.
(The format of our PDB-style files is described here.)

Timeline for d4zwvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zwvb2