SCOPe 2.06: Domain d4zaea_: 4zae A:

Lineage for d4zaea_ (4zae A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Coagulation factor IXa, protease domain [50583] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50585] (16 PDB entries)

8. Domain d4zaea_: 4zae A: [273585]
   Other proteins in same PDB: d4zaeb_
   automated match to d3lc3a_
   complexed with 4m1, na, nhe

Details for d4zaea_

PDB Entry: 4zae, 1.86 Å

PDB Description: development of a novel class of potent and selective fixa inhibitors

PDB Compounds: (A:) coagulation factor ix

SCOPe Domain Sequences for d4zaea_:

Sequence; same for both SEQRES and ATOM records:

>d4zaea_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgasalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektkl

Timeline for d4zaea_:

• d4zaea_ first appeared in SCOPe 2.05
  
• d4zaea_ appears in SCOPe 2.07
  
• d4zaea_ appears in the current release, SCOPe 2.08