SCOPe 2.05: Domain d4zaeb_: 4zae B:

Lineage for d4zaeb_ (4zae B:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (71 PDB entries)

8. Domain d4zaeb_: 4zae B: [273573]
   Other proteins in same PDB: d4zaea_
   automated match to d2wphe_
   complexed with 4m1, na, nhe

Details for d4zaeb_

PDB Entry: 4zae, 1.86 Å

PDB Description: development of a novel class of potent and selective fixa inhibitors

PDB Compounds: (B:) coagulation factor ix

SCOPe Domain Sequences for d4zaeb_:

Sequence; same for both SEQRES and ATOM records:

>d4zaeb_ g.3.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqt

Timeline for d4zaeb_:

• d4zaeb_ is new in SCOPe 2.05-stable
  
• d4zaeb_ appears in SCOPe 2.06
  
• d4zaeb_ appears in the current release, SCOPe 2.08