Lineage for d4z7uh2 (4z7u H:129-256)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765135Domain d4z7uh2: 4z7u H:129-256 [273556]
    Other proteins in same PDB: d4z7ua1, d4z7ua2, d4z7ub1, d4z7uc1, d4z7uc2, d4z7ud1, d4z7ue2, d4z7ug2
    automated match to d2vlme2
    complexed with fuc, nag

Details for d4z7uh2

PDB Entry: 4z7u (more details), 2.7 Å

PDB Description: s13 complex
PDB Compounds: (H:) T-cell receptor, s13 beta chain

SCOPe Domain Sequences for d4z7uh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7uh2 b.1.1.0 (H:129-256) automated matches {Homo sapiens [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4z7uh2:

Click to download the PDB-style file with coordinates for d4z7uh2.
(The format of our PDB-style files is described here.)

Timeline for d4z7uh2: