SCOPe 2.06: Domain d4z7wa2: 4z7w A:82-180

Lineage for d4z7wa2 (4z7w A:82-180)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

Domain d4z7wa2: 4z7w A:82-180 [273546]
Other proteins in same PDB: d4z7wa1, d4z7wb1, d4z7wb2, d4z7wc1, d4z7wd1, d4z7wd2, d4z7we1, d4z7wf1, d4z7wg1, d4z7wh1
automated match to d1uvqa1
complexed with fuc, man, nag, so4

Details for d4z7wa2

PDB Entry: 4z7w (more details), 2.89 Å

PDB Description: t316 complex

PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4z7wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7wa2 b.1.1.2 (A:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldepllkhwep

SCOPe Domain Coordinates for d4z7wa2:

Click to download the PDB-style file with coordinates for d4z7wa2.
(The format of our PDB-style files is described here.)

Timeline for d4z7wa2: