Lineage for d4z7wa2 (4z7w A:82-180)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762674Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)
  8. 1762791Domain d4z7wa2: 4z7w A:82-180 [273546]
    Other proteins in same PDB: d4z7wa1, d4z7wb1, d4z7wb2, d4z7wc1, d4z7wd1, d4z7wd2, d4z7we1, d4z7wf1, d4z7wg1, d4z7wh1
    automated match to d1uvqa1
    complexed with fuc, man, nag, so4

Details for d4z7wa2

PDB Entry: 4z7w (more details), 2.89 Å

PDB Description: t316 complex
PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4z7wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7wa2 b.1.1.2 (A:82-180) automated matches {Homo sapiens [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldepllkhwep

SCOPe Domain Coordinates for d4z7wa2:

Click to download the PDB-style file with coordinates for d4z7wa2.
(The format of our PDB-style files is described here.)

Timeline for d4z7wa2: