SCOPe 2.05: Domain d4y16d2: 4y16 D:113-240

Lineage for d4y16d2 (4y16 D:113-240)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus, [TaxId:10090] [272265] (6 PDB entries)

8. Domain d4y16d2: 4y16 D:113-240 [273520]
   Other proteins in same PDB: d4y16a1, d4y16b_, d4y16c2
   automated match to d3q5ya2
   complexed with 48g, ful, nag

Details for d4y16d2

PDB Entry: 4y16, 2.6 Å

PDB Description: crystal structure of the mcd1d/nc-agc/inktcr ternary complex

PDB Compounds: (D:) Chimeric TCR Vbeta8.2 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4y16d2:

Sequence; same for both SEQRES and ATOM records:

>d4y16d2 b.1.1.0 (D:113-240) automated matches {Mus musculus, [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4y16d2:

• d4y16d2 is new in SCOPe 2.05-stable
  
• d4y16d2 appears in SCOPe 2.06
  
• d4y16d2 appears in the current release, SCOPe 2.08