SCOP 1.61: Domain d1sleb_: 1sle B:

Lineage for d1sleb_ (1sle B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (89 PDB entries)

8. Domain d1sleb_: 1sle B: [27352]

Details for d1sleb_

PDB Entry: 1sle, 1.9 Å

PDB Description: streptavidin, ph 5.0, bound to cyclic peptide ac-chpqgppc-nh2

SCOP Domain Sequences for d1sleb_:

Sequence; same for both SEQRES and ATOM records:

>d1sleb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d1sleb_:

• d1sleb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sleb_ appears in SCOP 1.59
  
• d1sleb_ appears in SCOP 1.63
  
• d1sleb_ appears in the current release, SCOPe 2.08