![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
![]() | Domain d4y16c2: 4y16 C:115-203 [273517] Other proteins in same PDB: d4y16a1, d4y16a2, d4y16b_, d4y16c1, d4y16d1, d4y16d2 automated match to d2pyfa2 complexed with 48g, ful, nag |
PDB Entry: 4y16 (more details), 2.6 Å
SCOPe Domain Sequences for d4y16c2:
Sequence, based on SEQRES records: (download)
>d4y16c2 b.1.1.2 (C:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d4y16c2 b.1.1.2 (C:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnkdfacanafnnsiipedtffps
Timeline for d4y16c2: