Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (27 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [194536] (6 PDB entries) |
Domain d3x1xa_: 3x1x A: [273467] automated match to d4dxaa_ complexed with cd, gnp, mg |
PDB Entry: 3x1x (more details), 1 Å
SCOPe Domain Sequences for d3x1xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x1xa_ c.37.1.8 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl edervvgkeqgqnlarqwsncaflessakskinvneifydlvrqin
Timeline for d3x1xa_: