Lineage for d4w8lb_ (4w8l B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832951Species Paenibacillus barcinonensis [TaxId:198119] [273460] (1 PDB entry)
  8. 2832953Domain d4w8lb_: 4w8l B: [273463]
    automated match to d3mmda_
    complexed with ca, gol

Details for d4w8lb_

PDB Entry: 4w8l (more details), 1.76 Å

PDB Description: structure of gh10 from paenibacillus barcinonensis
PDB Compounds: (B:) Endo-1,4-beta-xylanase C

SCOPe Domain Sequences for d4w8lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w8lb_ c.1.8.0 (B:) automated matches {Paenibacillus barcinonensis [TaxId: 198119]}
nipdlakklgssyalgaaidqtaldpkdphselltkhfnsitagnfmkmdamqptegkfv
wseadklvnfaaannmqvrghtllwhsqvpdwfftdpndpskpatreqlmqrmkthiqti
vsrykgkvhtwdvvnevisdggglrnqasgskwrdiigdvdgdgddsdyielafryarea
dpdavlvindygiegsvskmndmvklvekllakgtpidaigfqmhvsmygpdikqireaf
nraaalgvhiqvteldmsiysgnseqekpvtdemmleqayryralfdlfkefddrgvmds
vtlwgladdgtwlddfpvkgrkdapllfdrklkakpaywalvdpstlpvyrn

SCOPe Domain Coordinates for d4w8lb_:

Click to download the PDB-style file with coordinates for d4w8lb_.
(The format of our PDB-style files is described here.)

Timeline for d4w8lb_: