Lineage for d4w8lc_ (4w8l C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820589Species Paenibacillus barcinonensis [TaxId:198119] [273460] (1 PDB entry)
  8. 1820592Domain d4w8lc_: 4w8l C: [273461]
    automated match to d3mmda_
    complexed with ca, gol

Details for d4w8lc_

PDB Entry: 4w8l (more details), 1.76 Å

PDB Description: structure of gh10 from paenibacillus barcinonensis
PDB Compounds: (C:) Endo-1,4-beta-xylanase C

SCOPe Domain Sequences for d4w8lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w8lc_ c.1.8.0 (C:) automated matches {Paenibacillus barcinonensis [TaxId: 198119]}
nipdlakklgssyalgaaidqtaldpkdphselltkhfnsitagnfmkmdamqptegkfv
wseadklvnfaaannmqvrghtllwhsqvpdwfftdpndpskpatreqlmqrmkthiqti
vsrykgkvhtwdvvnevisdggglrnqasgskwrdiigdvdgdgddsdyielafryarea
dpdavlvindygiegsvskmndmvklvekllakgtpidaigfqmhvsmygpdikqireaf
nraaalgvhiqvteldmsiysgnseqekpvtdemmleqayryralfdlfkefddrgvmds
vtlwgladdgtwlddfpvkgrkdapllfdrklkakpaywalvdpstlpvyrn

SCOPe Domain Coordinates for d4w8lc_:

Click to download the PDB-style file with coordinates for d4w8lc_.
(The format of our PDB-style files is described here.)

Timeline for d4w8lc_: