Lineage for d4s11a_ (4s11 A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (22 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries) 
Domain d4s11a_: 4s11 A: [273449]
automated match to d4cdgc_
mutant
Details for d4s11a_
PDB Entry: 4s11 (more details), 2 Å
PDB Description: gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis
PDB Compounds: (A:) gelsolin nanobodySCOPe Domain Sequences for d4s11a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s11a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtrya
dsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqgt
qvtvsshhh
SCOPe Domain Coordinates for d4s11a_:
Click to download the PDB-style file with coordinates for d4s11a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4s11a_:
- d4s11a_ first appeared in SCOPe 2.05
- d4s11a_ is called d4s11a1 in SCOPe 2.07
- d4s11a_ appears in the current release, SCOPe 2.08, called d4s11a1
View in 3D