Lineage for d1vwab_ (1vwa B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.61: Streptavidin-like [50875] (8 superfamilies)
barrel, closed; n=8, S=10; meanderSuperfamily b.61.1: Avidin/streptavidin [50876] (2 families) 
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) Protein Streptavidin [50878] (1 species) Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries) 
Domain d1vwab_: 1vwa B: [27344]
Details for d1vwab_
PDB Entry: 1vwa (more details), 1.85 Å
PDB Description: streptavidin-fshpqnt
PDB Compounds: (B:) streptavidinSCOPe Domain Sequences for d1vwab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vwab_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp
SCOPe Domain Coordinates for d1vwab_:
Click to download the PDB-style file with coordinates for d1vwab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vwab_:
- d1vwab_ first appeared (with stable ids) in SCOP 1.55
- d1vwab_ appears in SCOPe 2.07
View in 3D
