Lineage for d2n1td_ (2n1t D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591003Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2591004Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2591034Protein Synaptosomal-associated protein SNAP-25 [88915] (3 species)
    provides up to two different helical regions to synaptic fusion complexes
  7. 2591035Species Human (Homo sapiens) [TaxId:9606] [88917] (4 PDB entries)
    Uniprot P60880 146-204 # identical sequence to rat species
  8. 2591044Domain d2n1td_: 2n1t D: [273436]
    Other proteins in same PDB: d2n1ta_, d2n1tb_, d2n1te1, d2n1te2
    automated match to d1sfcd_

Details for d2n1td_

PDB Entry: 2n1t (more details)

PDB Description: dynamic binding mode of a synaptotagmin-1-snare complex in solution
PDB Compounds: (D:) synaptosomal-associated protein 25

SCOPe Domain Sequences for d2n1td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n1td_ h.1.15.1 (D:) Synaptosomal-associated protein SNAP-25 {Human (Homo sapiens) [TaxId: 9606]}
ggfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnkt
rideanqratkmlg

SCOPe Domain Coordinates for d2n1td_:

Click to download the PDB-style file with coordinates for d2n1td_.
(The format of our PDB-style files is described here.)

Timeline for d2n1td_: