Lineage for d2n1ta_ (2n1t A:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591003Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2591004Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2591017Protein Synaptobrevin [88903] (3 species)
  7. 2591024Species Norway rat (Rattus norvegicus) [TaxId:10116] [88904] (4 PDB entries)
  8. 2591030Domain d2n1ta_: 2n1t A: [273435]
    Other proteins in same PDB: d2n1tb_, d2n1tc_, d2n1td_, d2n1te1, d2n1te2
    automated match to d1sfca_

Details for d2n1ta_

PDB Entry: 2n1t (more details)

PDB Description: dynamic binding mode of a synaptotagmin-1-snare complex in solution
PDB Compounds: (A:) vesicle-associated membrane protein 2

SCOPe Domain Sequences for d2n1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n1ta_ h.1.15.1 (A:) Synaptobrevin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nltsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaakl
krkywwknl

SCOPe Domain Coordinates for d2n1ta_:

Click to download the PDB-style file with coordinates for d2n1ta_.
(The format of our PDB-style files is described here.)

Timeline for d2n1ta_: