SCOPe 2.08: Domain d2n1ta_: 2n1t A:

Lineage for d2n1ta_ (2n1t A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Synaptobrevin [88903] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88904] (4 PDB entries)

8. Domain d2n1ta_: 2n1t A: [273435]
   Other proteins in same PDB: d2n1tb_, d2n1tc_, d2n1td_, d2n1te1, d2n1te2
   automated match to d1sfca_

Details for d2n1ta_

PDB Entry: 2n1t

PDB Description: dynamic binding mode of a synaptotagmin-1-snare complex in solution

PDB Compounds: (A:) vesicle-associated membrane protein 2

SCOPe Domain Sequences for d2n1ta_:

Sequence; same for both SEQRES and ATOM records:

>d2n1ta_ h.1.15.1 (A:) Synaptobrevin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nltsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaakl
krkywwknl

Timeline for d2n1ta_:

• d2n1ta_ first appeared in SCOPe 2.05
  
• d2n1ta_ appears in SCOPe 2.07