Lineage for d2n1tb_ (2n1t B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591003Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2591004Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2591102Protein automated matches [254664] (2 species)
    not a true protein
  7. 2591107Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (4 PDB entries)
  8. 2591112Domain d2n1tb_: 2n1t B: [273432]
    Other proteins in same PDB: d2n1ta_, d2n1tc_, d2n1td_, d2n1te1, d2n1te2
    automated match to d1sfcj_

Details for d2n1tb_

PDB Entry: 2n1t (more details)

PDB Description: dynamic binding mode of a synaptotagmin-1-snare complex in solution
PDB Compounds: (B:) syntaxin-1a

SCOPe Domain Sequences for d2n1tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n1tb_ h.1.15.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
skqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyvera
vsdtkkavkyqs

SCOPe Domain Coordinates for d2n1tb_:

Click to download the PDB-style file with coordinates for d2n1tb_.
(The format of our PDB-style files is described here.)

Timeline for d2n1tb_: