Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (20 species) not a true protein |
Species Advenella mimigardefordensis [TaxId:1247726] [273374] (2 PDB entries) |
Domain d5ahsf1: 5ahs F:2-232 [273397] Other proteins in same PDB: d5ahsa2, d5ahsb2, d5ahsc2, d5ahsd2, d5ahse2, d5ahsf2 automated match to d1jqia2 complexed with coa, fad, sin, so4 |
PDB Entry: 5ahs (more details), 2.3 Å
SCOPe Domain Sequences for d5ahsf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ahsf1 e.6.1.0 (F:2-232) automated matches {Advenella mimigardefordensis [TaxId: 1247726]} yeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggr glstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpai cisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgiga fitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdgl
Timeline for d5ahsf1: