Lineage for d5ahsd2 (5ahs D:233-392)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1732074Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1732075Protein automated matches [226935] (21 species)
    not a true protein
  7. 1732079Species Advenella mimigardefordensis [TaxId:1247726] [273384] (2 PDB entries)
  8. 1732085Domain d5ahsd2: 5ahs D:233-392 [273395]
    Other proteins in same PDB: d5ahsa1, d5ahsb1, d5ahsc1, d5ahsd1, d5ahse1, d5ahsf1
    automated match to d1jqia1
    complexed with coa, fad, sin, so4

Details for d5ahsd2

PDB Entry: 5ahs (more details), 2.3 Å

PDB Description: 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimgardefordensis dpn7t: holo crystal structure with the substrate analog succinyl-coa
PDB Compounds: (D:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5ahsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ahsd2 a.29.3.0 (D:233-392) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
krgfaalmsaynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadm
svqleaarlmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpm
erhvrdarmftiaggtaqilrtqvaskildmklpqtrdgy

SCOPe Domain Coordinates for d5ahsd2:

Click to download the PDB-style file with coordinates for d5ahsd2.
(The format of our PDB-style files is described here.)

Timeline for d5ahsd2: