SCOPe 2.05: Domain d5af7a2: 5af7 A:233-392

Lineage for d5af7a2 (5af7 A:233-392)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (21 species)
   not a true protein

7. Species Advenella mimigardefordensis [TaxId:1247726] [273384] (2 PDB entries)

8. Domain d5af7a2: 5af7 A:233-392 [273391]
   Other proteins in same PDB: d5af7a1, d5af7b1
   automated match to d1jqia1
   complexed with fad, gol

Details for d5af7a2

PDB Entry: 5af7, 1.89 Å

PDB Description: 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimigardefordensis dpn7t: crystal structure and function of a desulfinase with an acyl-coa dehydrogenase fold. native crystal structure

PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5af7a2:

Sequence; same for both SEQRES and ATOM records:

>d5af7a2 a.29.3.0 (A:233-392) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
krgfaalmsaynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadm
svqleaarlmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpm
erhvrdarmftiaggtaqilrtqvaskildmklpqtrdgy

Timeline for d5af7a2:

• d5af7a2 is new in SCOPe 2.05-stable
  
• d5af7a2 appears in SCOPe 2.06
  
• d5af7a2 appears in the current release, SCOPe 2.08