SCOPe 2.06: Domain d5ahsc2: 5ahs C:233-392

Lineage for d5ahsc2 (5ahs C:233-392)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (26 species)
   not a true protein

7. Species Advenella mimigardefordensis [TaxId:1247726] [273384] (2 PDB entries)

8. Domain d5ahsc2: 5ahs C:233-392 [273390]
   Other proteins in same PDB: d5ahsa1, d5ahsb1, d5ahsc1, d5ahsd1, d5ahse1, d5ahsf1
   automated match to d1jqia1
   complexed with coa, fad, sin, so4

Details for d5ahsc2

PDB Entry: 5ahs, 2.3 Å

PDB Description: 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimgardefordensis dpn7t: holo crystal structure with the substrate analog succinyl-coa

PDB Compounds: (C:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5ahsc2:

Sequence; same for both SEQRES and ATOM records:

>d5ahsc2 a.29.3.0 (C:233-392) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
krgfaalmsaynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadm
svqleaarlmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpm
erhvrdarmftiaggtaqilrtqvaskildmklpqtrdgy

Timeline for d5ahsc2:

• d5ahsc2 first appeared in SCOPe 2.05
  
• d5ahsc2 appears in SCOPe 2.07
  
• d5ahsc2 appears in the current release, SCOPe 2.08