Lineage for d5af7b1 (5af7 B:3-232)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246257Species Advenella mimigardefordensis [TaxId:1247726] [273374] (2 PDB entries)
  8. 2246259Domain d5af7b1: 5af7 B:3-232 [273388]
    Other proteins in same PDB: d5af7a2, d5af7b2
    automated match to d1jqia2
    complexed with fad, gol

Details for d5af7b1

PDB Entry: 5af7 (more details), 1.89 Å

PDB Description: 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimigardefordensis dpn7t: crystal structure and function of a desulfinase with an acyl-coa dehydrogenase fold. native crystal structure
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5af7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5af7b1 e.6.1.0 (B:3-232) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
eltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggrg
lstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpaic
isepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgigaf
itvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdgl

SCOPe Domain Coordinates for d5af7b1:

Click to download the PDB-style file with coordinates for d5af7b1.
(The format of our PDB-style files is described here.)

Timeline for d5af7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5af7b2