SCOPe 2.05: Domain d5af7b1: 5af7 B:3-232

Lineage for d5af7b1 (5af7 B:3-232)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (20 species)
   not a true protein

7. Species Advenella mimigardefordensis [TaxId:1247726] [273374] (2 PDB entries)

8. Domain d5af7b1: 5af7 B:3-232 [273388]
   Other proteins in same PDB: d5af7a2, d5af7b2
   automated match to d1jqia2
   complexed with fad, gol

Details for d5af7b1

PDB Entry: 5af7, 1.89 Å

PDB Description: 3-sulfinopropionyl-coenzyme a (3sp-coa) desulfinase from advenella mimigardefordensis dpn7t: crystal structure and function of a desulfinase with an acyl-coa dehydrogenase fold. native crystal structure

PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5af7b1:

Sequence; same for both SEQRES and ATOM records:

>d5af7b1 e.6.1.0 (B:3-232) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
eltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggrg
lstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpaic
isepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgigaf
itvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdgl

Timeline for d5af7b1:

• d5af7b1 is new in SCOPe 2.05-stable
  
• d5af7b1 appears in SCOPe 2.06
  
• d5af7b1 appears in the current release, SCOPe 2.08