Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d4zrue_: 4zru E: [273338] Other proteins in same PDB: d4zrua2, d4zrub2, d4zrud2, d4zruf2, d4zrug2, d4zruh2, d4zrui2, d4zruj2 automated match to d4alxa_ complexed with po4, ti9 |
PDB Entry: 4zru (more details), 1.9 Å
SCOPe Domain Sequences for d4zrue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrue_ b.96.1.1 (E:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkk
Timeline for d4zrue_: