SCOPe 2.06: Domain d4zetb_: 4zet B:

Lineage for d4zetb_ (4zet B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d4zetb_: 4zet B: [273321]
   automated match to d3whdc_
   complexed with ca, gal, man, nag

Details for d4zetb_

PDB Entry: 4zet, 2.9 Å

PDB Description: blood dendritic cell antigen 2 (bdca-2) complexed with galglcnacman

PDB Compounds: (B:) C-type lectin domain family 4 member C

SCOPe Domain Sequences for d4zetb_:

Sequence; same for both SEQRES and ATOM records:

>d4zetb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altcvmegkdiedwsccptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintree
qdfiiqnlkrnssyflglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfr
sseewgwndihchvpqksickmkkiyi

Timeline for d4zetb_:

• d4zetb_ first appeared in SCOPe 2.05
  
• d4zetb_ appears in SCOPe 2.07
  
• d4zetb_ appears in the current release, SCOPe 2.08