SCOPe 2.01: Domain d1vwcb_: 1vwc B:

Lineage for d1vwcb_ (1vwc B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)

8. Domain d1vwcb_: 1vwc B: [27327]

Details for d1vwcb_

PDB Entry: 1vwc, 1.86 Å

PDB Description: streptavidin-cyclo-ac-[chpqfc]-nh2, ph 2.0

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1vwcb_:

Sequence; same for both SEQRES and ATOM records:

>d1vwcb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d1vwcb_:

• d1vwcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1vwcb_ appears in SCOP 1.75
  
• d1vwcb_ appears in SCOPe 2.02
  
• d1vwcb_ appears in the current release, SCOPe 2.08