SCOPe 2.08: Domain d4y4kd2: 4y4k D:113-240

Lineage for d4y4kd2 (4y4k D:113-240)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4y4kd2: 4y4k D:113-240 [273266]
   Other proteins in same PDB: d4y4ka1, d4y4kb_, d4y4kc2
   automated match to d3q5ya2
   complexed with 49y, nag

Details for d4y4kd2

PDB Entry: 4y4k, 2.9 Å

PDB Description: crystal structure of the mcd1d/ef77/inktcr ternary complex

PDB Compounds: (D:) chimeric TCR Vbeta8.2 chain (mouse variable, human constant domain)

SCOPe Domain Sequences for d4y4kd2:

Sequence; same for both SEQRES and ATOM records:

>d4y4kd2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4y4kd2:

• d4y4kd2 first appeared in SCOPe 2.05
  
• d4y4kd2 appears in SCOPe 2.07