SCOPe 2.05: Domain d4y4hh1: 4y4h H:2-112

Lineage for d4y4hh1 (4y4h H:2-112)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (26 species)
not a true protein
Species Mus musculus, [TaxId:10090] [272265] (6 PDB entries)
Domain d4y4hh1: 4y4h H:2-112 [273263]
Other proteins in same PDB: d4y4ha1, d4y4hb_, d4y4hc2, d4y4he1, d4y4hf_, d4y4hg2
automated match to d3q5ya1
complexed with 49x, nag

Details for d4y4hh1

PDB Entry: 4y4h (more details), 3.1 Å

PDB Description: crystal structure of the mcd1d/gck152/inktcr ternary complex

PDB Compounds: (H:) Chimeric TCR Vbeta8.2 chain (mouse variable domain/ human constant domain)

SCOPe Domain Sequences for d4y4hh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y4hh1 b.1.1.0 (H:2-112) automated matches {Mus musculus, [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d4y4hh1:

Click to download the PDB-style file with coordinates for d4y4hh1.
(The format of our PDB-style files is described here.)

Timeline for d4y4hh1: