Lineage for d4y4kc2 (4y4k C:115-203)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031327Domain d4y4kc2: 4y4k C:115-203 [273259]
    Other proteins in same PDB: d4y4ka1, d4y4ka2, d4y4kb_, d4y4kc1, d4y4kd1, d4y4kd2
    automated match to d2pyfa2
    complexed with 49y, fuc, nag

Details for d4y4kc2

PDB Entry: 4y4k (more details), 2.9 Å

PDB Description: crystal structure of the mcd1d/ef77/inktcr ternary complex
PDB Compounds: (C:) chimeric TCR Valpha14Jalpha18 chain (mouse variable, human constant domain)

SCOPe Domain Sequences for d4y4kc2:

Sequence, based on SEQRES records: (download)

>d4y4kc2 b.1.1.2 (C:115-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4y4kc2 b.1.1.2 (C:115-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4y4kc2:

Click to download the PDB-style file with coordinates for d4y4kc2.
(The format of our PDB-style files is described here.)

Timeline for d4y4kc2: