![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries) Uniprot P01887 |
![]() | Domain d4y4hb_: 4y4h B: [273246] Other proteins in same PDB: d4y4ha1, d4y4ha2, d4y4hc1, d4y4hc2, d4y4hd1, d4y4hd2, d4y4he1, d4y4he2, d4y4hg1, d4y4hg2, d4y4hh1, d4y4hh2 automated match to d3gmob_ complexed with 49x, nag |
PDB Entry: 4y4h (more details), 3.1 Å
SCOPe Domain Sequences for d4y4hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y4hb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws fyilahteftptetdtyacrvkhasmaepktvywdr
Timeline for d4y4hb_: