SCOPe 2.05: Domain d4y4he1: 4y4h E:7-185

Lineage for d4y4he1 (4y4h E:7-185)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)

8. Domain d4y4he1: 4y4h E:7-185 [273244]
   Other proteins in same PDB: d4y4ha2, d4y4hb_, d4y4hc1, d4y4hc2, d4y4hd1, d4y4hd2, d4y4he2, d4y4hf_, d4y4hg1, d4y4hg2, d4y4hh1, d4y4hh2
   automated match to d3hujc1
   complexed with 49x, nag

Details for d4y4he1

PDB Entry: 4y4h, 3.1 Å

PDB Description: crystal structure of the mcd1d/gck152/inktcr ternary complex

PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4y4he1:

Sequence; same for both SEQRES and ATOM records:

>d4y4he1 d.19.1.1 (E:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d4y4he1:

• d4y4he1 is new in SCOPe 2.05-stable
  
• d4y4he1 appears in SCOPe 2.06
  
• d4y4he1 appears in the current release, SCOPe 2.08