SCOPe 2.02: Domain d1swgc_: 1swg C:

Lineage for d1swgc_ (1swg C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (120 PDB entries)

8. Domain d1swgc_: 1swg C: [27324]
   circular permuted streptavidin e51/a46
   complexed with btn

Details for d1swgc_

PDB Entry: 1swg, 1.8 Å

PDB Description: circular permuted streptavidin e51/a46 in complex with biotin

PDB Compounds: (C:) circularly permuted core-streptavidin e51/a46

SCOPe Domain Sequences for d1swgc_:

Sequence; same for both SEQRES and ATOM records:

>d1swgc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
sryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwllt
sgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadgalt
gtyesa

Timeline for d1swgc_:

• d1swgc_ first appeared (with stable ids) in SCOP 1.55
  
• d1swgc_ appears in SCOPe 2.01
  
• d1swgc_ appears in SCOPe 2.03
  
• d1swgc_ appears in the current release, SCOPe 2.08