Lineage for d4y2dh1 (4y2d H:2-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767401Species Mus musculus, [TaxId:10090] [272265] (6 PDB entries)
  8. 1767417Domain d4y2dh1: 4y2d H:2-112 [273239]
    Other proteins in same PDB: d4y2da1, d4y2db_, d4y2dc2, d4y2de1, d4y2df_, d4y2dg2
    automated match to d3q5ya1
    complexed with 7dw, fu4, nag

Details for d4y2dh1

PDB Entry: 4y2d (more details), 3.05 Å

PDB Description: crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
PDB Compounds: (H:) Chimeric TCR Vbeta8.2 chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4y2dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y2dh1 b.1.1.0 (H:2-112) automated matches {Mus musculus, [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d4y2dh1:

Click to download the PDB-style file with coordinates for d4y2dh1.
(The format of our PDB-style files is described here.)

Timeline for d4y2dh1: