SCOPe 2.05: Domain d4y4ha2: 4y4h A:186-279

Lineage for d4y4ha2 (4y4h A:186-279)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d4y4ha2: 4y4h A:186-279 [273238]
   Other proteins in same PDB: d4y4ha1, d4y4hb_, d4y4hc2, d4y4he1, d4y4hf_, d4y4hg2
   automated match to d3hujc2
   complexed with 49x, nag

Details for d4y4ha2

PDB Entry: 4y4h, 3.1 Å

PDB Description: crystal structure of the mcd1d/gck152/inktcr ternary complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4y4ha2:

Sequence, based on SEQRES records:

>d4y4ha2 b.1.1.0 (A:186-279) automated matches {Mus musculus [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d4y4ha2 b.1.1.0 (A:186-279) automated matches {Mus musculus [TaxId: 10090]}
qekpvawlssvprqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatl
dveageeaglacrvkhsslggqdiilyw

Timeline for d4y4ha2:

• d4y4ha2 is new in SCOPe 2.05-stable
  
• d4y4ha2 appears in SCOPe 2.06
  
• d4y4ha2 appears in the current release, SCOPe 2.07