Lineage for d4y2de1 (4y2d E:6-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182598Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2182641Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 2182668Domain d4y2de1: 4y2d E:6-185 [273221]
    Other proteins in same PDB: d4y2db_, d4y2dc1, d4y2dc2, d4y2dd1, d4y2dd2, d4y2df_, d4y2dg1, d4y2dg2, d4y2dh1, d4y2dh2
    automated match to d3hujc1
    complexed with 7dw, fu4, nag

Details for d4y2de1

PDB Entry: 4y2d (more details), 3.05 Å

PDB Description: crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4y2de1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y2de1 d.19.1.1 (E:6-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d4y2de1:

Click to download the PDB-style file with coordinates for d4y2de1.
(The format of our PDB-style files is described here.)

Timeline for d4y2de1: