SCOPe 2.06: Domain d4uscb_: 4usc B:

Lineage for d4uscb_ (4usc B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (11 species)
   not a true protein

7. Species Trachycarpus fortunei [TaxId:14027] [273214] (1 PDB entry)

8. Domain d4uscb_: 4usc B: [273216]
   automated match to d3hdla_
   complexed with ca, edo, hem, man, nag, peg, peo, so4

Details for d4uscb_

PDB Entry: 4usc, 2.6 Å

PDB Description: crystal structure of peroxidase from palm tree chamaerops excelsa

PDB Compounds: (B:) Peroxidase

SCOPe Domain Sequences for d4uscb_:

Sequence; same for both SEQRES and ATOM records:

>d4uscb_ a.93.1.0 (B:) automated matches {Trachycarpus fortunei [TaxId: 14027]}
dlqigfynqscpsaeslvqqgvaaafannsgiapglirmhfhdcfvrgcdgsvlldstdt
ntaekdaapnnpslrgfeviaaaksaveaacpktvscadilafaardsaalagnityqvp
sgrrdgnvslasealtnipaptfnatqlinsfagknltademvtlsgahsigvshcfsfl
nriynfsntsqvdptlsssyadllrtkcpsnstrftpitvsldiitptvldnryytgvql
tlglltsdqalvteanlsaavknnadnltawvaefaqaivkmgqievltgtqgeirtncs
vvn

Timeline for d4uscb_:

• d4uscb_ first appeared in SCOPe 2.05
  
• d4uscb_ appears in SCOPe 2.07
  
• d4uscb_ appears in the current release, SCOPe 2.08