SCOPe 2.08: Domain d4rydd1: 4ryd D:110-442

Lineage for d4rydd1 (4ryd D:110-442)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (15 proteins)

6. Protein automated matches [190073] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [238473] (13 PDB entries)

8. Domain d4rydd1: 4ryd D:110-442 [273175]
   Other proteins in same PDB: d4ryda2, d4rydb2, d4rydc2, d4rydd2, d4ryde2, d4rydf2
   automated match to d1p8ja2
   complexed with ca, fmt, na

Details for d4rydd1

PDB Entry: 4ryd, 2.15 Å

PDB Description: x-ray structure of human furin in complex with the competitive inhibitor para-guanidinomethyl-phac-r-tle-r-amba

PDB Compounds: (D:) Furin

SCOPe Domain Sequences for d4rydd1:

Sequence; same for both SEQRES and ATOM records:

>d4rydd1 c.41.1.1 (D:110-442) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan
dwatngvgrkvshsygyglldagamvalaqnwt

Timeline for d4rydd1:

• d4rydd1 first appeared in SCOPe 2.05
  
• d4rydd1 appears in SCOPe 2.07