Lineage for d4rcya1 (4rcy A:2-206)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1847337Species Sulfolobus solfataricus [TaxId:273057] [256083] (11 PDB entries)
  8. 1847343Domain d4rcya1: 4rcy A:2-206 [273170]
    Other proteins in same PDB: d4rcya2, d4rcya3
    automated match to d2qn6a3
    complexed with gdp, gtp, mg, mpd; mutant

Details for d4rcya1

PDB Entry: 4rcy (more details), 1.65 Å

PDB Description: structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gtp
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4rcya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rcya1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
awpkvqpevnigvvghvahgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

SCOPe Domain Coordinates for d4rcya1:

Click to download the PDB-style file with coordinates for d4rcya1.
(The format of our PDB-style files is described here.)

Timeline for d4rcya1: