Lineage for d4rcza2 (4rcz A:207-320)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1792044Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1792045Protein automated matches [226946] (19 species)
    not a true protein
  7. 1792113Species Sulfolobus solfataricus [TaxId:273057] [256084] (11 PDB entries)
  8. 1792115Domain d4rcza2: 4rcz A:207-320 [273168]
    Other proteins in same PDB: d4rcza1, d4rcza3
    automated match to d4m53a2
    complexed with gnp, mg, mpd; mutant

Details for d4rcza2

PDB Entry: 4rcz (more details), 1.43 Å

PDB Description: structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gdpnp
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4rcza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rcza2 b.43.3.0 (A:207-320) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d4rcza2:

Click to download the PDB-style file with coordinates for d4rcza2.
(The format of our PDB-style files is described here.)

Timeline for d4rcza2: