Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [256083] (13 PDB entries) |
Domain d4rd2a1: 4rd2 A:2-206 [273161] Other proteins in same PDB: d4rd2a2, d4rd2a3 automated match to d2qn6a3 complexed with gnp, mg, mpd |
PDB Entry: 4rd2 (more details), 1.59 Å
SCOPe Domain Sequences for d4rd2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rd2a1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces ckkpeayvtepsckscgsddepkflrrisfidapgaevlmatmlsgaalmdgailvvaan epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii pvsalhkinidsliegieeyiktpy
Timeline for d4rd2a1: