Lineage for d4z0kb_ (4z0k B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258282Protein Factor IX (IXa) [57198] (2 species)
  7. 2258283Species Human (Homo sapiens) [TaxId:9606] [57199] (17 PDB entries)
  8. 2258286Domain d4z0kb_: 4z0k B: [273061]
    Other proteins in same PDB: d4z0ka_
    automated match to d2wphe_
    complexed with 4ln, cl, na, nhe

Details for d4z0kb_

PDB Entry: 4z0k (more details), 1.41 Å

PDB Description: rapid development of two factor ixa inhibitors from hit to lead
PDB Compounds: (B:) coagulation factor ix

SCOPe Domain Sequences for d4z0kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z0kb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}
dvtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsq

SCOPe Domain Coordinates for d4z0kb_:

Click to download the PDB-style file with coordinates for d4z0kb_.
(The format of our PDB-style files is described here.)

Timeline for d4z0kb_: