Lineage for d4xpal2 (4xpa L:109-214)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767332Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)
  8. 1767385Domain d4xpal2: 4xpa L:109-214 [273047]
    automated match to d2i9la2
    complexed with 42j, cl, clr, n9s, na

Details for d4xpal2

PDB Entry: 4xpa (more details), 2.95 Å

PDB Description: x-ray structure of drosophila dopamine transporter bound to 3, 4dichlorophenethylamine
PDB Compounds: (L:) antibody fragment heavy chain-protein, 9d5-heavy chain

SCOPe Domain Sequences for d4xpal2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xpal2 b.1.1.0 (L:109-214) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4xpal2:

Click to download the PDB-style file with coordinates for d4xpal2.
(The format of our PDB-style files is described here.)

Timeline for d4xpal2: