Lineage for d1srgb_ (1srg B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 958655Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 958656Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 958657Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 958680Protein Streptavidin [50878] (1 species)
  7. 958681Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)
  8. 958793Domain d1srgb_: 1srg B: [27304]
    complexed with mhb

Details for d1srgb_

PDB Entry: 1srg (more details), 1.8 Å

PDB Description: structure-based design of synthetic azobenzene ligands for streptavidin
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1srgb_:

Sequence, based on SEQRES records: (download)

>d1srgb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1srgb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapasgtalgwtv
awknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1srgb_:

Click to download the PDB-style file with coordinates for d1srgb_.
(The format of our PDB-style files is described here.)

Timeline for d1srgb_: