SCOP 1.61: Domain d1slfd_: 1slf D:

Lineage for d1slfd_ (1slf D:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (89 PDB entries)

8. Domain d1slfd_: 1slf D: [27300]

Details for d1slfd_

PDB Entry: 1slf, 1.73 Å

PDB Description: apostreptavidin, ph 5.6, two molecules of (so4)2 bound at the biotin binding site

SCOP Domain Sequences for d1slfd_:

Sequence; same for both SEQRES and ATOM records:

>d1slfd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d1slfd_:

• d1slfd_ first appeared (with stable ids) in SCOP 1.55
  
• d1slfd_ appears in SCOP 1.59
  
• d1slfd_ appears in SCOP 1.63
  
• d1slfd_ appears in the current release, SCOPe 2.08