SCOPe 2.05: Domain d4q47b3: 4q47 B:408-514

Lineage for d4q47b3 (4q47 B:408-514)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [272918] (2 PDB entries)

8. Domain d4q47b3: 4q47 B:408-514 [272928]
   Other proteins in same PDB: d4q47a1, d4q47a2, d4q47b1, d4q47b2
   automated match to d1oywa1
   protein/DNA complex; complexed with adp, zn

Details for d4q47b3

PDB Entry: 4q47, 2.9 Å

PDB Description: structure of the drrecq catalytic core in complex with adp

PDB Compounds: (B:) DNA helicase RecQ

SCOPe Domain Sequences for d4q47b3:

Sequence; same for both SEQRES and ATOM records:

>d4q47b3 a.4.5.0 (B:408-514) automated matches {Deinococcus radiodurans [TaxId: 243230]}
prvrdltreaqmalsatirtgnrfgaahltdvllgretdkvlaqghhqlptfgvgkehde
klwrsvlrqlvslgylsaddhfglratgksrgilkegqklllredtl

Timeline for d4q47b3:

• d4q47b3 is new in SCOPe 2.05-stable
  
• d4q47b3 appears in SCOPe 2.06
  
• d4q47b3 appears in the current release, SCOPe 2.08