SCOPe 2.08: Domain d4phla_: 4phl A:

Lineage for d4phla_ (4phl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)

8. Domain d4phla_: 4phl A: [272913]
   automated match to d4i15a_
   complexed with eoh, gai, gol, mg, pil, zn

Details for d4phla_

PDB Entry: 4phl, 1.95 Å

PDB Description: tbrpdeb1-inhibitor complex

PDB Compounds: (A:) Class 1 phosphodiesterase PDEB1

SCOPe Domain Sequences for d4phla_:

Sequence; same for both SEQRES and ATOM records:

>d4phla_ a.211.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
taitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkfg
csdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllita
lvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfggleg
aertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisnv
tkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapff
qkivdaclqgmqwtvdriksnraqwervle

Timeline for d4phla_:

• d4phla_ first appeared in SCOPe 2.05
  
• d4phla_ appears in SCOPe 2.07