SCOPe 2.08: Domain d4orbb_: 4orb B:

Lineage for d4orbb_ (4orb B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [272883] (1 PDB entry)

8. Domain d4orbb_: 4orb B: [272884]
   Other proteins in same PDB: d4orba_
   automated match to d1tcob_
   complexed with ca, fe, zn

Details for d4orbb_

PDB Entry: 4orb, 3.11 Å

PDB Description: crystal structure of mouse calcineurin

PDB Compounds: (B:) Calcineurin subunit B type 1

SCOPe Domain Sequences for d4orbb_:

Sequence; same for both SEQRES and ATOM records:

>d4orbb_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Mouse (Mus musculus) [TaxId: 10090]}
syplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtd
gngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlk
dtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv

Timeline for d4orbb_:

• d4orbb_ first appeared in SCOPe 2.05
  
• d4orbb_ appears in SCOPe 2.07