SCOPe 2.05: Domain d4oq0a_: 4oq0 A:

Lineage for d4oq0a_ (4oq0 A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (55 PDB entries)

8. Domain d4oq0a_: 4oq0 A: [272871]
   automated match to d4ibra_
   complexed with 2ul, ca, edo, peg; mutant

Details for d4oq0a_

PDB Entry: 4oq0, 1.42 Å

PDB Description: crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutation in complex with boron-based inhibitor ec25

PDB Compounds: (A:) TEM-94 ES-beta-lactamase

SCOPe Domain Sequences for d4oq0a_:

Sequence; same for both SEQRES and ATOM records:

>d4oq0a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldswepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

Timeline for d4oq0a_:

• d4oq0a_ is new in SCOPe 2.05-stable
  
• d4oq0a_ appears in SCOPe 2.06
  
• d4oq0a_ appears in the current release, SCOPe 2.08