Lineage for d4opqa_ (4opq A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (27 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (75 PDB entries)
  8. 2569435Domain d4opqa_: 4opq A: [272864]
    automated match to d4ibra_
    complexed with ca, peg, pg4, so4; mutant

Details for d4opqa_

PDB Entry: 4opq (more details), 1.7 Å

PDB Description: room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutations
PDB Compounds: (A:) TEM-94 ES-beta-lactamase

SCOPe Domain Sequences for d4opqa_:

Sequence, based on SEQRES records: (download)

>d4opqa_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldswepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

Sequence, based on observed residues (ATOM records): (download)

>d4opqa_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldswepelnderdtttpvamattlrklltgelltaasrqqlidw
meadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtgsqatm
dernrqiaeigaslikhw

SCOPe Domain Coordinates for d4opqa_:

Click to download the PDB-style file with coordinates for d4opqa_.
(The format of our PDB-style files is described here.)

Timeline for d4opqa_: