Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
Protein automated matches [190344] (3 species) not a true protein |
Species Coccidioides immitis [TaxId:246410] [272845] (1 PDB entry) |
Domain d5b8ia_: 5b8i A: [272846] Other proteins in same PDB: d5b8ib_, d5b8ic_ automated match to d1m63a_ complexed with ca, edo, fe, fk5, mes, zn |
PDB Entry: 5b8i (more details), 1.85 Å
SCOPe Domain Sequences for d5b8ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b8ia_ d.159.1.3 (A:) automated matches {Coccidioides immitis [TaxId: 246410]} lervckevqapafhtptneqfwspvdpskpnlaflkqhfyregrltedqalwiiqagtel lraepnllemdapitvcgdvhgqyydlmklfevggdpaetrylflgdyvdrgyfsiecvl ylwalkiwypntlwllrgnhecrhltdyftfkleckhkysekvydacmesfcalplaaim nkqflcihgglspelhtlediksidrfreppthglmcdilwadpledfgtektgeyfvhn nvrgcsfffsypaacafleknnllsiiraheaqdagyrmyqktrttgfpsvmtifsapny ldvynnkaavlkyennvmnirqfnctphpywlpnfmdvftwslpfvgekitdmliailn
Timeline for d5b8ia_: